missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204332

Invitrogen™ Human CTGF (aa 143-216) Control Fragment Recombinant Protein

Product Code. 30204332
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204332 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204332 Supplier Invitrogen™ Supplier No. RP94720

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111012 (PA5-111012. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Connective Tissue Growth Factor (CTGF), also called CCN2, is a member of the CCN family. CTGF is a secreted protein produced by umbilical veins and vascular endothelial cells. CTGF possesses an Insulin-like Growth Factor (IGF)-binding domain, a thrombospondin type 1 domain, and a cysteine knot region. CTGF plays important roles in the proliferation and differentiation of chondrocytes, induces angiogenesis, and promotes cell adhesion in fibroblasts, endothelial, and epithelial cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P29279
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1490
Name Human CTGF (aa 143-216) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2-Nov; betaIG-M2; CCN family member 2; Ccn2; Cellular communication network factor 2; connective tissue growth factor; connective tissue growth factor precursor; Connective tissue growth factor precursor (CTGF) (FISP-12 protein) (Hypertrophic chondrocyte-specific protein 24); connective tissue growth-related protein; CTGF; CTGF protein; CTGRP; fibroblast inducible secreated protein; fibroblast inducible secreted protein; Fisp12; fisp-12; Hcs24; H-CTGF; hypertrophic chondrocyte-specific gene product 24; hypertrophic chondrocyte-specific protein 24; IBP-8; IGF-binding protein 8; IGFBP8; IGFBP-8; Insulin-like growth factor-binding protein 8; MGC102839; NOV2; Protein FISP-12; similar to connective tissue growth factor precursor
Common Name CTGF
Gene Symbol CCN2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.