missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CRMP1 Partial ORF (NP_001014809.1, 221 a.a. - 310 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001400-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16073845

  • 341.70 € / 10µg

Estimated Shipment: 30-12-2021
Add to basket

Description

Description

This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL
Specifications

Specifications

NP_001014809.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL
RUO
CRMP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1400
CRMP1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DPYSL1/DRP-1/DRP1
CRMP1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions