missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195264

Invitrogen™ Human CHD3 (aa 1558-1658) Control Fragment Recombinant Protein

Product Code. 30195264
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195264 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195264 Supplier Invitrogen™ Supplier No. RP108089

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67428 (PA5-67428. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12873
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1107
Name Human CHD3 (aa 1558-1658) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2600010P09Rik; AF020312; ATP-dependent helicase CHD3; CG9594; CG9594-PA; CHD3; CHD-3; Chd3-PA; Chd7; chromodomain helicase DNA binding protein 3; chromodomain-helicase-DNA-binding protein 3; dCHD3; DmCHD3; Dmel\CG9594; Dmel_CG9594; hZFH; MGC40857; Mi 2 A; Mi2 ALPHA; Mi-2 alpha; mi-2 autoantigen 240 kDa protein; Mi-2 A; Mi2-alpha; Prp7; Prp9 1; Prp9-1; ZFH; Zinc finger helicase; zinc-finger helicase (Snf2-like)
Common Name CHD3
Gene Symbol CHD3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEVPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.