missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CHC1 Partial ORF (AAH07300, 312 a.a. - 421 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00001104-Q01.25ug

Weitere Details : Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16183151

  • 467.00 € / 25 Mikrogramm


Verfügbar ab
16-02-2021
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Sequence: EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Spezifikation

Spezifikation

AAH07300
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
RUO
RCC1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1104
CHC1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CHC1|RCC1-I
RCC1
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation