missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194857

Invitrogen™ Human CEP63 (aa 378-469) Control Fragment Recombinant Protein

Product Code. 30194857
Click to view available options
Quantity:
100 μL
missing translation for 'unitSize'
100µL
This item is not returnable. View return policy

Product Code. 30194857

missing translation for 'mfr': Invitrogen™ RP96466

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63530 (PA5-63530. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CEP63 is a protein with six coiled-coil domains. The protein is localized to the centrosome, a non-membranous organelle that functions as the major microtubule-organizing center in animal cells.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number Q96MT8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80254
Name Human CEP63 (aa 378-469) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4921501M07; AL450317.13 gm1; AW107703; CD20R; centrosomal protein 63; centrosomal protein 63 kDa; centrosomal protein of 63 kDa; centrosome protein Cep63; CEP63; D9Mgc41; D9Mgc48e; ET2; LOW QUALITY PROTEIN: centrosomal protein of 63 kDa; SCKL6
Common Name CEP63
Gene Symbol CEP63
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHLTQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt