missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200119

Invitrogen™ Human CaMKII delta (aa 438-497) Control Fragment Recombinant Protein

Product Code. 30200119
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200119

Brand: Invitrogen™ RP95069

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82907 (PA5-82907. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CaMKII delta belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. is a delta chain. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Distinct isoforms of this chain have different expression patterns.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13557
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 817
Name Human CaMKII delta (aa 438-497) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias [d]-CaMKII; 2810011D23Rik; 8030469K03Rik; Ca++/calmodulin-dependent protein kinase 2 delta subunit; Ca++/calmodulin-dependent protein kinase II delta subunit; Ca++/calmodulin-dependent protein kinase II, delta subunit; calcium/calmodulin dependent protein kinase II delta; calcium/calmodulin-dependent protein kinase (CaM kinase) II delta; calcium/calmodulin-dependent protein kinase II delta; calcium/calmodulin-dependent protein kinase II, delta; calcium/calmodulin-dependent protein kinase type II delta chain; calcium/calmodulin-dependent protein kinase type II subunit delta; calmodulin-dependent protein kinase II-delta dash; CaM kinase II delta subunit; caM kinase II subunit delta; CAM2; CaMK II; CAMK1; Camk2; CAMK2B; Camk2d; CAMK2G; CAMKB; CAMKD; CAMKG; Camki; CaMK-II delta subunit; CaMK-II subunit delta; CaM-kinase II delta chain; Kiaa4163; RATCAMKI
Common Name CaMKII delta
Gene Symbol Camk2d
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.