missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Calpain 11 (aa 547-629) Control Fragment Recombinant Protein

Product Code. 30211770
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211770 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211770 Supplier Invitrogen™ Supplier No. RP94868

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83168 (PA5-83168. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The calpains including Calpain 1 (CAPN1), calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. Diseases associated with CAPN1 include Spastic Paraplegia 76, Autosomal Recessive and Spasticity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UMQ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11131
Name Human Calpain 11 (aa 547-629) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias calcium-activated neutral proteinase 11; calcium-activated neutral proteinase 11 {ECO:0000250; calcium-dependent thiol protease; calpain 11; calpain 11 {ECO:0000312; calpain11; Calpain-11; calpain-11; LOW QUALITY PROTEIN: calpain-11; CANP 11; CANP 11 {ECO:0000250; Capn11; capn11 {ECO:0000312; EMBL:AAH97256.1}; HIP2; LIG; RGD:1302946}; UniProtKB:Q9UMQ6}
Common Name Calpain 11
Gene Symbol CAPN11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.