missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human C4BPB (aa 43-118) Control Fragment Recombinant Protein

Product Code. 30200625
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200625

Brand: Invitrogen™ RP94168

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62443 (PA5-62443. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Complement component 4-binding protein (C4BP) is a plasma glycoprotein that inhibits the classical pathway of complement activation, which is mediated through antibody targeting of foreign antigen. Structurally, C4BP is a disulfide linked, multimeric protein that is composed of seven alpha chains and one beta chain. C4BP functions as a cofactor for C3beta inactivator in the cleavage of C3beta, and accelerates the decay of C4betaC2alpha (C3 convertase) by acting as a cofactor in the cleavage of C4beta by factor I. Streptococcal strains that express Ig-binding cell surface molecules, which are members of the M protein family, can bind to overlapping C4beta binding sites in C4BP and therefore, interfere with the classical pathway of complement activation. Bacteria-bound C4BP may be an evolved mechanism that downregulates complement activation in the bacterial host microenvironment, thereby reducing the occurrences of bacterial opsonization and phagocytosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P20851
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 725
Name Human C4BPB (aa 43-118) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C4b-binding protein beta chain; C4BP; C4BPB; C4bp-ps1; complement component 4 binding protein beta; complement component 4 binding protein, beta; complement component 4 binding protein, pseudogene 1
Common Name C4BPB
Gene Symbol C4BPB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.