missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204022

Invitrogen™ Human BHLHB5 (aa 329-379) Control Fragment Recombinant Protein

Product Code. 30204022
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204022

Brand: Invitrogen™ RP103544

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64152 (PA5-64152. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BHLHB5 inhibits DNA binding of TCF3/E47 homodimers and TCF3 (E47)/NEUROD1 heterodimers and acts as a strong repressor of Neurod1 and Myod-responsive genes, probably by heterodimerization with class a basic helix-loop-helix factors. BHLHB5 despite the presence of an intact basic domain, does not bind to DNA.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NFJ8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27319
Name Human BHLHB5 (aa 329-379) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias basic helix-loop-helix (bHLH) gene, class B, beta3; basic helix-loop-helix domain containing, class B, 5; basic helix-loop-helix domain containing, class B5; basic helix-loop-helix family member e22; basic helix-loop-helix family, member e22; Beta3; BHLHB5; bHLHe22; CAGL85; Class B basic helix-loop-helix protein 5; class E basic helix-loop-helix protein 22; Protein BETA3; TNRC20; trinucleotide repeat containing 20; trinucleotide repeat-containing gene 20 protein
Common Name BHLHB5
Gene Symbol BHLHE22
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALFNSVSSSLCKQCTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.