missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human B4GALT5 (aa 351-388) Control Fragment Recombinant Protein

Product Code. 30202741
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202741 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202741 Supplier Invitrogen™ Supplier No. RP109790

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145174 (PA5-145174. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43286
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9334
Name Human B4GALT5 (aa 351-388) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4-gal; 9430078I07Rik; AW049941; AW539721; B4GALT5; B4Gal-T5; Beta-1,4-galactosyltransferase 5; beta-1,4-galactosyltransferase V; beta-1,4-GalT II; beta-1,4-GalT IV; beta-1,4-GalTase 5; beta-1.4-galactosyltransferase V; beta4-GalT IV; beta4Gal-T5; BETA4-GALT-IV; beta4GalT-V; Bgt-5; Glucosylceramide beta-1,4-galactosyltransferase; gt-V; LacCer synthase; Lactosylceramide synthase; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5
Common Name B4GALT5
Gene Symbol B4GALT5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.