missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196794

Invitrogen™ Human AP1S1 (aa 128-158) Control Fragment Recombinant Protein

Product Code. 30196794
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196794 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196794 Supplier Invitrogen™ Supplier No. RP104531

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63913 (PA5-63913. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AP1S1 is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P61966
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1174
Name Human AP1S1 (aa 128-158) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias adapter-related protein complex 1 sigma-1 A subunit; adapter-related protein complex 1 subunit sigma-1 A; adaptor protein complex AP-1 sigma-1 A subunit; adaptor protein complex AP-1 subunit sigma-1 A; adaptor protein complex AP-1, sigma 1; adaptor related protein complex 1 sigma 1 subunit; adaptor related protein complex 1 subunit sigma 1; adaptor-related protein complex 1 sigma 1 subunit; adaptor-related protein complex 1 subunit sigma-1 A; adaptor-related protein complex 1, sigma 1 subunit; adaptor-related protein complex AP-1, sigma 1; AP-1 complex subunit sigma-1 A; AP19; AP1S1; ap1s1 protein; CLAPS1; Clathrin assembly protein complex 1 sigma-1 A small chain; clathrin coat assembly protein AP19; clathrin-associated/assembly/adaptor protein, small 1 (19 kD); EKV3; golgi adaptor HA1/AP1 adaptin sigma-1 A subunit; HA1 19 kDa subunit; MEDNIK; N-terminus-conjugating E2; sigma 1 A subunit of AP-1 clathrin; SIGMA1A; sigma1A subunit of AP-1 clathrin adaptor complex; sigma1A-adaptin; Sigma-adaptin 1 A; Ube2w; ubiquitin carrier protein W; ubiquitin-conjugating enzyme E2 W; ubiquitin-protein ligase W; WUGSC:H_DJ0747G18.2; zgc:56704; zgc:85689
Common Name AP1S1
Gene Symbol Ap1s1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.