missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AKT3 Partial ORF (AAD29089, 100 a.a. - 189 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010000-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101606

  • 341.70 € / 10µg

Estimated Shipment: 23-12-2021
Add to basket

Description

Description

The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Sequence: EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Specifications

Specifications

AAD29089
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.53kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
RUO
AKT3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10000
AKT3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp434N0250/PKB-GAMMA/PKBG/PRKBG/RAC-PK-gamma/RAC-gamma/STK-2
AKT3
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions