missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207314

Invitrogen™ Human AGTPBP1 (aa 1138-1219) Control Fragment Recombinant Protein

Product Code. 30207314
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207314

Brand: Invitrogen™ RP109242

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UPW5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23287
Name Human AGTPBP1 (aa 1138-1219) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700020N17Rik; 2310001G17Rik; 2900054O13Rik; 4930445M19Rik; 5730402G09Rik; agtpbp1; ATP/GTP binding protein 1; ATP/GTP-binding protein 1; carboxypeptidase-tubulin; CCP1; Cytosolic carboxypeptidase 1; cytosolic carboxypeptidase 1; LOW QUALITY PROTEIN: cytosolic carboxypeptidase 1; Cytosolic carboxypeptidase 1-like protein; DKFZp686M20191; KIAA1035; Nervous system nuclear protein induced by axotomy protein 1; nervous system nuclear protein induced by axotomy protein 1 homolog; nmf243; Nna1; nuclear ATP/GTP-binding protein; pcd; Purkinje cell degeneration; si:ch73-236b16.2; soluble carboxypeptidase; tubulinyl-Tyr carboxypeptidase; tyrosine carboxypeptidase
Common Name AGTPBP1
Gene Symbol AGTPBP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.