missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195066

Invitrogen™ Human Abl2 (aa 561-656) Control Fragment Recombinant Protein

Product Code. 30195066
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195066 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195066 Supplier Invitrogen™ Supplier No. RP108607

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84910 (PA5-84910. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ABL2 (Arg) is an Abl-related non-receptor protein tyrosine kinase that links cell surface receptors to cell proliferation and/or cytoskeletal reorganization. Abl2 encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. Abl2 is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P42684
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27
Name Human Abl2 (aa 561-656) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA536808; Abelson murine leukemia viral (v-abl) oncogene homolog 2; abelson murine leukemia viral oncogene homolog 2; Abelson tyrosine-protein kinase 2; Abelson-related gene protein; ABL proto-oncogene 2, non-receptor tyrosine kinase; Abl1-related gene product; abl2; ABLL; ARG; arg tyrosine kinase; c-abl oncogene 2, non-receptor tyrosine kinase; FLJ22224; FLJ31718; FLJ41441; tyrosine kinase ARG; tyrosine-protein kinase ABL2; Tyrosine-protein kinase ARG; v-abl Abelson murine leukemia viral oncogene 2; v-abl Abelson murine leukemia viral oncogene 2 (arg, Abelson-related gene); v-abl Abelson murine leukemia viral oncogene homolog 2; v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
Common Name Abl2
Gene Symbol ABL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.