missing translation for 'onlineSavingsMsg'
Learn More

HSD17B3 Antibody, Novus Biologicals™

Product Code. 18636075 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18636075 25 μL 25µL
18032276 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18636075 Supplier Novus Biologicals Supplier No. NBP23880725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

HSD17B3 Polyclonal specifically detects HSD17B3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HSD17B3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P37058
Gene Alias EC 1.1.1.64, EDH17B317-beta-HSD3, hydroxysteroid (17-beta) dehydrogenase 3,17-beta-hydroxysteroid dehydrogenase type 3, SDR12C2, short chain dehydrogenase/reductase family 12C, member 2, Testicular 17-beta-hydroxysteroid dehydrogenase, testosterone 17-beta-dehydrogenase 3,17-beta-HSD 3
Gene Symbols HSD17B3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: NVGILPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLIL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Prostate Cancer
Primary or Secondary Primary
Gene ID (Entrez) 3293
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.