missing translation for 'onlineSavingsMsg'
Learn More

HLA DPB1 Antibody [PE], Novus Biologicals Biologicals™

Product Code. 30499977 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30499977 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30499977 Supplier Novus Biologicals Supplier No. NBP335275PE

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

HLA DPB1 Polyclonal antibody specifically detects HLA DPB1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen HLA DPB1
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate PE
Formulation PBS
Gene Alias DP beta 1 chain, DPB1, HLA class II histocompatibility antigen, DP(W4) beta chain, HLA DP14-beta chain, HLA-DP histocompatibility type, beta-1 subunit, HLA-DP1B, HLA-DPB, major histocompatibility complex class II HLA DPB1 protein, major histocompatibility complex, class II, DP beta 1, MHC class II antigen beta chain, MHC class II antigen DP beta 1 chain, MHC class II antigen DPB1, MHC class II antigen DPbeta1, MHC class II HLA-DP-beta, MHC HLA DPB1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-100 of human HLA DPB1 (NP_002112.3).,, Sequence:, GRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Asthma, Diabetes Research, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3115
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.