missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HERV Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-60024
This item is not returnable.
View return policy
Description
HERV Polyclonal specifically detects HERV in Human samples. It is validated for Western Blot.
Specifications
| HERV | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| endogenous retroviral family W, env(C7), member 1, ENV, envelope glycoprotein, Envelope polyprotein gPr73, enverin, Env-W, ENVW, HERV-7q, HERV7Q, HERV-7q Envelope protein, HERV-tryptophan envelope protein, HERV-W, HERV-W Env glycoprotein, HERV-W envelope protein, HERV-W_7q21.2 provirus ancestral Env polyprotein, HERV-W(7q21.1) provirus ancestral Env polyprotein, HERVWENV, HERV-W-ENV, HERVWenvelope protein, human endogenous retrovirus W envC7-1 envelope protein, Syncytin, syncytin A, Syncytin-1 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 30816 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UQF0 | |
| ERVW-1 | |
| Synthetic peptides corresponding to ERVWE1(endogenous retroviral family W, env(C7), member 1 (syncytin)) The peptide sequence was selected from the N terminal of ERVWE1. Peptide sequence TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Lowland gorilla: 92%; Pileated gibbon: 85%; Bornean orangutan: 85%; Siamang: 85%; Chimpanzee: 78%;. | |
| Human, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction