missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRASP55 Antibody (CL2522), Novus Biologicals™
Mouse Monoclonal Antibody
280.00 € - 572.00 €
Specifications
| Antigen | GRASP55 |
|---|---|
| Clone | CL2522 |
| Dilution | Western Blot 1:500-1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000-1:10000 |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18640366
|
Novus Biologicals
NBP2-36769-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18147138
|
Novus Biologicals
NBP2-36769 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GRASP55 Monoclonal specifically detects GRASP55 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GRASP55 | |
| Western Blot 1:500-1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000-1:10000 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| Q9H8Y8 | |
| 26003 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV | |
| Primary | |
| Protein A purified |
| CL2522 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Mouse | |
| Golgi Apparatus Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Golgi phosphoprotein 6, golgi reassembly stacking protein 2, 55 kDa, golgi reassembly stacking protein 2, 55kDa, Golgi reassembly-stacking protein of 55 kDa, GOLPH6DKFZp434D156, GRASP55FLJ13139, GRS2Golgi reassembly-stacking protein 2, p59 | |
| GORASP2 | |
| IgG1 | |
| Protein A purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title