missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glycogen phosphorylase, muscle form Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Specifications
| Antigen | Glycogen phosphorylase, muscle form |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Mængde & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Mængde & tilgængelighed | |||||
|
30230957
|
Novus Biologicals
NBP3-38607-100ul |
100 μL |
550.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227275
|
Novus Biologicals
NBP3-38607-20ul |
20 μL |
190.00 €
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
Glycogen phosphorylase, muscle form Polyclonal antibody specifically detects Glycogen phosphorylase, muscle form in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotTekniske data
| Glycogen phosphorylase, muscle form | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| EC 2.4.1.1, glycogen phosphorylase, muscle form, myophosphorylase, phosphorylase, glycogen, muscle, phosphorylase, glycogen; muscle | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 743-842 of human Glycogen phosphorylase, muscle form (NP_005600.1).,, Sequence:, GMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 5837 | |
| IgG | |
| Affinity purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel