missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glutamate Dehydrogenase The Glutamate Dehydrogenase Recombinant Protein Antigen is derived from E. coli. The Glutamate Dehydrogenase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
Specifications
| Gene ID (Entrez) | 2746 |
| Protein Length | KPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | GLUD1 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4 |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | EC 1.4.1, EC 1.4.1.3, GDH 1, GDH, GDH1, GLUD |
| Gene Symbol | GLUD1 |
| Label Type | Unlabeled |
| Mehr anzeigen |
For Research Use Only.
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?