missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GEMIN2 Polyclonal antibody specifically detects GEMIN2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | GEMIN2 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 549 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | Component of gems 2, Gemin-2, GEMIN2survival of motor neuron protein-interacting protein 1, SIP1-delta, SMN interacting protein 1-delta, SMN-interacting protein 1, survival of motor neuron protein interacting protein 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 180-280 of human GEMIN2 (NP_003607.1),, Sequence:, LSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?