missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | GDF-9 |
| Applications | Western Blot, ELISA, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | GDF9/4261 |
| Conjugate | DyLight 488 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 |
| Host Species | Mouse |
| Immunogen | Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383) |
| Purification Method | Protein A or G purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?