missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GAS7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49422-25ul
This item is not returnable.
View return policy
Description
GAS7 Polyclonal antibody specifically detects GAS7 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| GAS7 | |
| Polyclonal | |
| Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| GAS-7, growth arrest-specific 7, KIAA0394growth arrest-specific protein 7, MGC1348, MLL/GAS7, MLL/GAS7 fusion protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKGRRKS | |
| 25 μL | |
| Cell Cycle and Replication | |
| 8522 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction