missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GADD45G Polyclonal antibody specifically detects GADD45G in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | GADD45G |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 525 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CR6DNA damage-inducible transcript 2 protein, Cytokine-responsive protein CR6, DDIT-2, DDIT2GADD45-gamma, growth arrest and DNA damage-inducible protein GADD45 gamma, growth arrest and DNA-damage-inducible, gamma, GRP1717 kD |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1).,, Sequence:, IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?