missing translation for 'onlineSavingsMsg'
Learn More

FUSIP1 Antibody, Novus Biologicals™

Product Code. 30229599 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30229599 100 μL 100µL
30232576 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30229599 Supplier Novus Biologicals Supplier No. NBP338220100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

FUSIP1 Polyclonal antibody specifically detects FUSIP1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen FUSIP1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias 40 kDa SR-repressor protein, FLJ43846, FUS interacting protein (serine-arginine rich) 1, FUS-interacting protein (serine-arginine rich) 2, FUS-interacting serine-arginine-rich protein 1, FUSIP1DKFZp686H0644, FUSIP2, neural-salient SR protein, NSSR, serine/arginine-rich splicing factor 10, serine-arginine repressor protein (40 kDa), SFRS13, SFRS13A, Splicing factor SRp38, splicing factor, arginine/serine-rich 13, Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats, SR splicing factor 10, SRp38, SRrp40TLS-associated protein with SR repeats, TASR1TLS-associated SR protein, TASR2FUS interacting protein (serine/arginine-rich) 1, TASRFLJ30749, TLS-associated protein TASR, TLS-associated serine-arginine protein, TLS-associated serine-arginine protein 1, TLS-associated serine-arginine protein 2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 163-262 of human FUSIP1 (NP_473357.1).,, Sequence:, DRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10772
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.