missing translation for 'onlineSavingsMsg'
Learn More

FAM132B Antibody, Novus Biologicals™

Product Code. 18035296 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18035296 100 μL 100µL
18672649 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18035296 Supplier Novus Biologicals Supplier No. NBP257732

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 2 publications

FAM132B Polyclonal specifically detects FAM132B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Immunoprecipitation.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FAM132B
Applications Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias C1qTNF15, Complement C1q Tumor Necrosis Factor-Related Protein 15, CTRP15, ERFE, Erythroferrone, Family With Sequence Similarity 132, Member B, Myonectin, Protein FAM132B
Gene Symbols FAM132B
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 151176
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.