missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EMSY Antibody (5D1), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00056946-M01
This item is not returnable.
View return policy
Description
EMSY Monoclonal antibody specifically detects EMSY in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
| EMSY | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| chromosome 11 open reading frame 30, EMSYFLJ90741, protein EMSY | |
| C11orf30 (NP_064578, 1081 a.a. ~ 1178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQASEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATS | |
| 0.1 mg | |
| Apoptosis, Cancer, DNA Repair, Tumor Suppressors | |
| 56946 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG3 κ |
| Western Blot, ELISA, Immunocytochemistry | |
| 5D1 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
| NP_064578 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction