missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18570734

EMR4P Antibody (1G10), Novus Biologicals™

Product Code. 18570734 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18570734 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18570734 Supplier Novus Biologicals Supplier No. H00326342M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

EMR4P Monoclonal antibody specifically detects EMR4P in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen EMR4P
Applications Western Blot, ELISA, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone 1G10
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Alias egf-like module containing, mucin-like, hormone receptor-like 4, egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene, EMR4EGF-like module receptor 4, FIRE, GPR127G-protein coupled receptor 127, G-protein coupled receptor PGR16, PGR16G protein-coupled receptor 127
Host Species Mouse
Immunogen EMR4P (XP_377506, 21 a.a. ∽ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline GPCR, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 326342
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.