missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ELAVL4 Polyclonal antibody specifically detects ELAVL4 in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | ELAVL4 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Biotin |
| Formulation | PBS |
| Gene Alias | abnormal vision, Drosophila, homolog of, like-4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), HuD, Paraneoplastic encephalomyelitis antigen HuD |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ELAVL4 (NP_068771.2).,, Sequence:, MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDA |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?