missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16394815

Invitrogen™ ELAVL2 Polyclonal Antibody

Product Code. 16394815 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16394815 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16394815 Supplier Invitrogen™ Supplier No. PA595553

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human T-47D whole cell, human A549 whole cell, human Caco-2 whole cell. IHC: mouse brain tissue, mouse brain tissue, mouse brain tissue, human glioma tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded by this gene is a neural-specific RNA-binding protein that is known to bind to several 3' UTRs, including its own and also that of FOS and ID. The encoded protein may recognize a GAAA motif in the RNA. Three transcript variants encoding two different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ELAVL2
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene ELAVL2
Gene Accession No. Q12926, Q60899, Q8CH84
Gene Alias ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B); ELAV like 4; ELAV like neuron-specific RNA binding protein 2; Elav2; ELAVL 2; ELAVL 4; ELAVL2; ELAV-like neuronal protein 1; ELAV-like neuronal protein 1 isoform Hel-N2; ELAV-like protein 2; embryonic lethal, abnormal vision-like 2; HELN1; HEL-N1; Hu antigen B; Hu antigen D; hu-antigen B; HUB; HUD; mel-N1; Nervous system-specific RNA-binding protein Hel-N1; nervous system-specific RNA-binding protein Mel-N1; RNA binding protein HuB; zgc:91918
Gene Symbols ELAVL2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human ELAVL2 HuB (METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 15569, 1993, 286973
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.