missing translation for 'onlineSavingsMsg'
Learn More

EEF1A2 Antibody, Novus Biologicals™

Product Code. 18182465 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18182465 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18182465 Supplier Novus Biologicals Supplier No. NBP233280

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

EEF1A2 Polyclonal specifically detects EEF1A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen EEF1A2
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Flow Cytometry 1:10-1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:10 - 1:500, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q05639
Gene Alias eEF1A-2, EEF1ALFLJ41696, EF1A, EF-1-alpha-2, elongation factor 1-alpha 2, elongation factor-1 alpha, Eukaryotic elongation factor 1 A-2, eukaryotic translation elongation factor 1 alpha 2, HS1, statin, statin S1, statin-like, Statin-S1, STN, STNL
Gene Symbols EEF1A2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cellular Signaling, Oncogenes, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 1917
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.