missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
EBP Polyclonal antibody specifically detects EBP in Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | EBP |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | 3-beta-hydroxysteroid-Delta(8), CDPX2, Cholestenol Delta-isomerase, CPX3-beta-hydroxysteroid-delta-8, CPXDX-linked dominant (Happle syndrome), D8-D7 sterol isomerase, Delta(7)-isomerase, Delta(8)-Delta(7) sterol isomerase, delta-7-isomerase, EC 5.3.3.5, emopamil binding protein (sterol isomerase), Emopamil-binding protein, sterol 8-isomerase |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EBP (NP_006570.1). SGRAAVVPLGTWRRLSLCWFAVCGFIHLVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITACLWGPLSLWVVIAFLRQHPLRFIL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?