missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EAR2/NR2F6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92225-0.1ml
This item is not returnable.
View return policy
Description
EAR2/NR2F6 Polyclonal antibody specifically detects EAR2/NR2F6 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| EAR2/NR2F6 | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| EAR-2ERBA-related gene-2, EAR2nuclear receptor subfamily 2 group F member 6, ERBAL2v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 2, nuclear receptor subfamily 2, group F, member 6, V-erbA-related protein 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human NR2F6 (NP_005225.2). MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVD | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2063 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction