missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DMGDH Antibody, R&D Systems™

DMGDH Antibody, R&D Systems™

Product Code. 18614427 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18614427 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18614427 Supplier Novus Biologicals Supplier No. NBP25801725ul
  • ONLINE EXCLUSIVE PRICE
    457.09 €
    391.65 € / 25µL
    Save 65.44 €
    14% Off
 Restricted Item
Estimated Shipment: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

DMGDH Polyclonal specifically detects DMGDH in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen DMGDH
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias dimethylglycine dehydrogenase, dimethylglycine dehydrogenase, mitochondrial, DMGDHD, EC 1.5.99.2, ME2GLYDH
Gene Symbols DMGDH
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AGARKCGALLKYPAPVTSLKARSDGTWDVETPQGSMRANRIVNAAGFWAREVGKMIGLEHPLIPVQHQYVVTSTISEVK
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29958
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Show More Show Less

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.