missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
DAX1/NR0B1 Polyclonal antibody specifically detects DAX1/NR0B1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | DAX1/NR0B1 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | AHCDSS, AHCH, AHX, DAX1DAX-1, dosage-sensitive sex reversal, DSS-AHC critical region on the X chromosome protein 1, GTD, HHG, NROB1, nuclear hormone receptor, Nuclear receptor DAX-1, nuclear receptor subfamily 0 group B member 1, nuclear receptor subfamily 0, group B, member 1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTT |
| Purification Method | Protein A purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?