missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DAX1/NR0B1 Antibody, Novus Biologicals™

DAX1/NR0B1 Antibody, Novus Biologicals™

Product Code. 18676308 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18676308 100 μg 100µL
18691758 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18676308 Supplier Novus Biologicals Supplier No. NBP268781

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

DAX1/NR0B1 Polyclonal antibody specifically detects DAX1/NR0B1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen DAX1/NR0B1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias AHCDSS, AHCH, AHX, DAX1DAX-1, dosage-sensitive sex reversal, DSS-AHC critical region on the X chromosome protein 1, GTD, HHG, NROB1, nuclear hormone receptor, Nuclear receptor DAX-1, nuclear receptor subfamily 0 group B member 1, nuclear receptor subfamily 0, group B, member 1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCF
Purification Method Protein A purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 190
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.