missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Cysteine Conjugate beta-Lyase/CCBL1 Antibody, Novus Biologicals™

Cysteine Conjugate beta-Lyase/CCBL1 Antibody, Novus Biologicals™

Product Code. 18439390 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18439390 25 μL 25µL
18263017 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18439390 Supplier Novus Biologicals Supplier No. NBP18331725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Cysteine Conjugate beta-Lyase/CCBL1 Polyclonal specifically detects Cysteine Conjugate beta-Lyase/CCBL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Cysteine Conjugate beta-Lyase/CCBL1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias cysteine conjugate-beta lyase, cytoplasmic, cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, Cysteine-S-conjugate beta-lyase, EC 2.6.1.64, EC 2.6.1.7, EC 4.4.1.13, FLJ95217, Glutamine transaminase K, glutamine-phenylpyruvate aminotransferase, Glutamine--phenylpyruvate transaminase, GTKMGC29624, KAT1, KATIbeta-lysase, kidney, kyneurenine aminotransferase, kyneurenine aminotransferase), Kynurenine aminotransferase I, kynurenine--oxoglutarate transaminase 1, Kynurenine--oxoglutarate transaminase I
Gene Symbols CCBL1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 883
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.