missing translation for 'onlineSavingsMsg'
Learn More

CRMP1 Antibody [DyLight 650], Novus Biologicals Biologicals™

Product Code. 30500268 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500268 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500268 Supplier Novus Biologicals Supplier No. NBP338009C

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CRMP1 Polyclonal antibody specifically detects CRMP1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CRMP1
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate DyLight 650
Formulation 50mM Sodium Borate
Gene Alias collapsin response mediator protein 1DRP1, CRMP-1, dihydropyrimidinase-like 1, dihydropyrimidinase-related protein 1, DPYSL1DRP-1dihydropyrimidinase related protein-1, ULIP3, ULIP-3, Unc-33-like phosphoprotein 3
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 460-540 of human CRMP1 (NP_001304.1).,, Sequence:, NVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 1400
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.