missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRIP1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 463.00 €
Specifications
| Antigen | CRIP1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18685212
|
Novus Biologicals
NBP2-92498-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18679161
|
Novus Biologicals
NBP2-92498-0.1ml |
0.1 mL |
463.00 €
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CRIP1 Polyclonal antibody specifically detects CRIP1 in Human, Mouse samples. It is validated for Western BlotSpecifications
| CRIP1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 1396 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| CRHP, CRIPCRP1, CRP-1, Cysteine-rich heart protein, Cysteine-rich intestinal protein, cysteine-rich protein 1, cysteine-rich protein 1 (intestinal), FLJ40971, hCRHP | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-77 of human CRIP1 (NP_001302.1). MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title