missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COG4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35646-20ul
This item is not returnable.
View return policy
Description
COG4 Polyclonal antibody specifically detects COG4 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| COG4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| CDG2J, COD1complexed with Dor1p, COG complex subunit 4, component of oligomeric golgi complex 4DKFZp586E1519, conserved oligomeric Golgi complex protein 4, conserved oligomeric Golgi complex subunit 4, DKFZP586E1519 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 310-410 of human COG4 (NP_056201.2).,, Sequence:, LQVECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEKIEPRELDPILTEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNN | |
| 20 μL | |
| Golgi Apparatus Markers | |
| 25839 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction