missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15965095

Invitrogen™ CD41 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15965095
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15965095 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15965095 Supplier Invitrogen™ Supplier No. PA579527

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEL whole cell, human HEL whole cell, human K562 whole cell. IHC: mouse lung tissue, rat lung tissue, human mammary cancer tissue.

CD41, also known as platelet glycoprotein IIb or ITGA2B, is a protein composed of two subunits: a 120 kDa alpha subunit and a 23 kDa beta subunit. It interacts with CD61 (gpIIIa, integrin beta III) in the presence of calcium to form a functional adhesive protein receptor. Initially thought to be expressed exclusively on platelets and megakaryocytes, CD41 is also found on hematopoietic progenitors in the embryo, fetus, and adult, indicating its role in early stages of hematopoietic differentiation. CD41 plays a crucial role in platelet function and blood coagulation by mediating platelet aggregation. Upon blood vessel damage, CD41 binds to various adhesion molecules, including von Willebrand factor, fibrinogen, fibronectin, and vitronectin, facilitating platelet adhesion and aggregation. This receptor is essential for platelet function, contributing to the binding of several adhesion molecules and playing a significant role in hemostasis. Diseases associated with CD41 dysfunction include Glanzmann Thrombasthenia and Platelet type-16 bleeding disorder, highlighting its importance in normal platelet function and blood coagulation processes.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CD41
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Itga2b
Gene Accession No. P08514, Q9QUM0
Gene Alias AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
Gene Symbols Itga2b
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 16399, 3674, 685269
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.