missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Calmodulin Antibody [Janelia Fluor« 549], Novus Biologicals Biologicals™
Shop All Bio Techne ProductsDescription
Calmodulin Polyclonal antibody specifically detects Calmodulin in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | Calmodulin |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Janelia Fluor 549 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | CALM, CALM2, CALM3, CALML2, calmodulin, calmodulin 1 (phosphorylase kinase, delta), CaM, CAM1, CAM2, CAM3, CAMB, CAMC, CAMI, CAMIII, DD132, PHKDCAM, phosphorylase kinase, delta subunit |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1).,, Sequence:, LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?