missing translation for 'onlineSavingsMsg'
Learn More
Learn More
beta-Galactosidase-1/GLB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49602
This item is not returnable.
View return policy
Description
beta-Galactosidase-1/GLB1 Polyclonal antibody specifically detects beta-Galactosidase-1/GLB1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| beta-Galactosidase-1/GLB1 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Acid beta-galactosidase, beta-galactosidase, EBP, EC 3.2.1.23, Elastin receptor 1, elastin receptor 1 (67kD), elastin receptor 1, 67kDa, ELNR1, galactosidase, beta 1, Lactase, MPS4B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV | |
| 0.1 mL | |
| metabolism | |
| 2720 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction