missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15984435

Invitrogen™ BCAR3 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15984435
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15984435 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15984435 Supplier Invitrogen™ Supplier No. PA578858

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HEPG2 whole cell. IHC: mouse lymphaden tissue, rat spleen tissue, human tonsil tissue.

Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48.
TRUSTED_SUSTAINABILITY

Specifications

Antigen BCAR3
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene BCAR3
Gene Accession No. O75815, Q9QZK2
Gene Alias AI131758; And34; AND-34; Bcar3; breast cancer anti-estrogen resistance 3; breast cancer antiestrogen resistance 3 protein; breast cancer anti-estrogen resistance protein 3; dJ1033H22.2 (breast cancer anti-estrogen resistance 3); KIAA0554; novel SH2-containing protein 2; NSP2; OTTHUMP00000011961; p130Cas-binding protein AND-34; SH2 domain-containing protein 3B; SH2D3B; UNQ271/PRO308
Gene Symbols BCAR3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29815, 310838, 8412
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.