missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B-Myb Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | B-Myb |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18223144
|
Novus Biologicals
NBP2-56847 |
100 μL |
593.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18626346
|
Novus Biologicals
NBP2-56847-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
B-Myb Polyclonal specifically detects B-Myb in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| B-Myb | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Core ESC Like Genes, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4605 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LQASHQQQVLPPRQPSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVALSPVTENSTSLSFLDSCNSLTPKSTPVKTLPF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| B-MYB, BMYBMGC15600, Myb-like protein 2, myb-related protein B, v-myb avian myeloblastosis viral oncogene homolog-like 2, v-myb myeloblastosis viral oncogene homolog (avian)-like 2 | |
| MYBL2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title