missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Autoimmune Regulator/AIRE Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
463.00 €
Specifications
| Antigen | Autoimmune Regulator/AIRE |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Autoimmune Regulator/AIRE Polyclonal specifically detects Autoimmune Regulator/AIRE in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Autoimmune Regulator/AIRE | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Immune System Diseases, Immunology | |
| PBS buffer, 2% sucrose | |
| 326 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| APECED protein, APECEDAPSI, Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein, autoimmune regulator, autoimmune regulator (APECED protein)10APS1AIRE1, autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermaldystrophy), PGA1 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human Autoimmune Regulator/AIRE (NP_000374). Peptide sequence HRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALL | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title