missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARL6IP4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92711-0.02ml
This item is not returnable.
View return policy
Description
ARL6IP4 Polyclonal antibody specifically detects ARL6IP4 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA
Specifications
| ARL6IP4 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:2000, ELISA | |
| ADP-ribosylation-like factor 6 interacting protein 4, Aip-4, ARL-6-interacting protein 4, HSP-975, HSVI binding protein, HSVI-binding protein, MGC814, SFRS20, splicing factor, arginine/serine-rich 20, splicing regulator SRrp38, SR-15, SR-25ADP-ribosylation factor-like protein 6-interacting protein 4, SRp25 nuclear protein, SRp25aip-4, SRrp37 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3). SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP | |
| 0.02 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 51329 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, ELISA | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction