missing translation for 'onlineSavingsMsg'
Learn More

ARL6IP4 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18680552 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18680552 0.1 mL 0.1mL
18693882 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18680552 Supplier Novus Biologicals Supplier No. NBP2927110.1ml

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

ARL6IP4 Polyclonal antibody specifically detects ARL6IP4 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ARL6IP4
Applications Western Blot, ELISA
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000 - 1:2000, ELISA
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias ADP-ribosylation-like factor 6 interacting protein 4, Aip-4, ARL-6-interacting protein 4, HSP-975, HSVI binding protein, HSVI-binding protein, MGC814, SFRS20, splicing factor, arginine/serine-rich 20, splicing regulator SRrp38, SR-15, SR-25ADP-ribosylation factor-like protein 6-interacting protein 4, SRp25 nuclear protein, SRp25aip-4, SRrp37
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 313-402 of human ARL6IP4 (NP_057722.3). SAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Biology, Cytoskeleton Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51329
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.