missing translation for 'onlineSavingsMsg'
Learn More

Aquaporin 1/AQP1 Antibody [HRP], Novus Biologicals Biologicals™

Product Code. 30498798 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498798 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498798 Supplier Novus Biologicals Supplier No. NBP335493H

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Aquaporin 1/AQP1 Polyclonal antibody specifically detects Aquaporin 1/AQP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Aquaporin 1/AQP1
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate HRP
Formulation PBS
Gene Alias 28-kDa, AQP-1, AQP-CHIP, aquaporin 1 (channel-forming integral protein, 28kDa), aquaporin 1 (Colton blood group), Aquaporin-CHIP, CHIP2828kDa, CO blood group), CO, MGC26324
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-269 of human Aquaporin 1/AQP1 (AQP1) (NP_932766.1).,, Sequence:, AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 358
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.