missing translation for 'onlineSavingsMsg'
Learn More

Apolipoprotein CIII Antibody (8H7), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00000345-M06

Product Code. 18328677

595.00 € / 0.01mg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Apolipoprotein CIII Monoclonal antibody specifically detects Apolipoprotein CIII in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	Apolipoprotein CIII
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	In 1x PBS, pH 7.4
Gene Alias	APOC3, apo-CIII, ApoC-III, APOCIII, Apolipoprotein C3, apolipoprotein C-III, MGC150353
Immunogen	APOC3 (NP_000031.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Quantity	0.1 mg
Research Discipline	Lipid and Metabolism
Gene ID (Entrez)	345
Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Isotype	IgG2a κ

Applications	Western Blot, ELISA, Immunocytochemistry
Clone	8H7
Dilution	Western Blot 1:100-1:2000, ELISA, Immunocytochemistry/ Immunofluorescence 1:10-1:2000
Gene Accession No.	NP_000031
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Apolipoprotein CIII Antibody (8H7), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions